anti aging FOXO4 D-Retro-Inverso peptide 95% FOXO4-DRI 98% Senolytics powder
EGF, FGF, KGF, SOD, FOXO4-dri and all cosmetic powder.
Raw powder and freeze-dired fine powder are both available.
P
hysical
C
haracter
s
and
specifications
Supply FOXO4-DRI raw powder and freeze powder in vials.
Name | FOXO4 DRI |
CAS | N/A |
Grade Standard | Injection grade |
COA | Pls contact with Senwayer freely |
MOQ | 10mg |
Appearance | White powder |
Purity, % (by RP-HPLC) | 95% |
Activity unit | N/A |
pH value | N/A |
Isoelectric point | N/A |
Water residue | N/A |
Identification test | N/A |
Storage | 2 - 8 degree |
EXP time | 2 years |
FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.
FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice
No. | Product Name | CAS No. |
Anti-wrinkle & Anti-aging Series | ||
1 | Acetyl Hexapeptide-8 | 616204-22-9 |
2 | Acetyl Octapeptide-3/Snap-8 | 868844-74-0 |
3 | Palmitoyl Tripeptide-5 /Collagen Peptide | 623172-56-5 |
4 | Palmitoyl Pentapeptide-4 /Matrixyl Acetate | 214047-00-4 |
5 | Pentapeptide-18 /Leuphasyl | 64963-01-5 |
6 | Hexapeptide-10/Serilesine | 146439-94-3 |
7 | Palmitoyl Hexapeptide / Lipopeptide Acetate | 171263-26-6 |
8 | Palmitoyl Tripeptide-1 | 147732-56-7 |
9 | Pentapeptide-3/Vialox Peptide | 135679-88-8 |
10 | Acetyl Tetrapeptide-2 | 757942-88-4 |
11 | Acetyl Tetrapeptide-9 | 928006-50-2 |
12 | L-Carnosine | 305-84-0 |
13 | Decorinyl/Tripeptide-10 Citrulline | 960531-53-7 |
14 | Palmitoyl Tripeptide-38 | 1447824-23-8 |
15 | Acetyl Decapeptide-3 | 935288-50-9 |
16 | Hexapeptide-11 | -------- |
Whitening & Freckle Removing Series | ||
1 | Nonapeptide-1/Melitane | 158563-45-2 |
2 | Tetrapeptide-30 | --------- |
3 | Decapeptide-12 | --------- |
4 | Hexapeptide-2 | --------- |
5 | Melanostatin DM | 123689-72-5 |
6 | Oligopeptide-68 | 1206525-47-4 |
Eye Care and Hair Growth Series | ||
1 | Acetyl Tetrapeptide-5/Eyeseryl | 820959-17-9 |
2 | Myristoyl Pentapeptide-17 | 959610-30-1 |
3 | Myristoyl Tetrapeptide-12 | 959610-24-3 |
4 | Acetyl Tetrapeptide-3/Capixyl | 155149-79-4 |
5 | Biotinoyl Tripeptide-1 | 299157-54-3 |
6 | Melitane/Acetyl Hexapeptide-1 | 448944-47-6 |
7 | Myristoyl Pentapeptide-4 | --------- |
Anti-allergic & Skin Repair Series | ||
1 | Pal-Tetrapeptide-7 /Pal-Tetrapeptide-3 | 221227-05-0 |
2 | Copper Peptide | 49557-75-7 |
3 | Hexapeptide-9 | 1228371-11-6 |
4 | Palmitoyl Tripeptide-8 | 936544-53-5 |
5 | Oligopeptide-10 | --------- |
6 | LZ1 Peptide | --------- |
Breast Series | ||
1 | Acetyl Hexapeptide-38 | 1400634-44-7 |
Weight Loss series | ||
1 | Acetyl Hexapeptide-39 | --------- |